Product description
|
Application: |
Analogue of insulin-like growth factor 1 |
|
CAS: |
112603-35-7 |
|
Molecular Weight: |
7371.4 g mol |
|
Chemical Formula: |
C319H501N91O96S7 |
|
Chemical Name: |
TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
|
Synonyms: |
IGF1 Human Des1-3; Insulin-Like Growth Factor 1 Des |
|
Storage: |
Minimize open air exposure, store in a cool dry place. |
|
Stability: |
2 years |
|
Solubility: |
Soluble to water at rate of 1 mg/mL |
|
Physical Form: |
fine powder in glass vial |
|
Specifications: |
1mg vial |
IGF-1 DES Peptide

Description
IGF-1 DES is actually produced from both Insulin and growth hormone in the liver and other tissues. IGF-1 is made up of 70 amino acids in a chain. Well, when a clever chemist removes the last 3 amino acids in the IGF-1 chain (the N-terminal tri-peptide) it becomes Des (1-3) IGF-1 and 1000% plus more anabolic.
IGF-1 DES (Insulin Growth Factor – 1 DES) is a single, non glycosylated polypeptide chain that is made up of 67 amino acids. It is the shorter version of the IGF-1 amino acid chain that contains amino acids 4-70 and as such it mimics the insulin structure. This polypeptide omits the first three amino acids at the N-terminus of IGF-1 and this omission considerably lowers its binding to the IGFBPs (insulin-like growth factor-binding proteins) and boosts its potency. Its structure has ensured that the properties of IGF-1 can be amplified with more stability.
Researchers posit that this absence of the tripeptide Gly-Pro-Glu may make IGF-1 DES 10x more potent than any stimulation IGF-1 may provide. Since the tripeptide is absent, researchers suggest that IGF-1 DES might not easily bind with the IGF-1 binding receptors, which may result in higher proliferation and differentiation of tissue cells.
Applications
IGF-1 DES has a wide range of applications in the fields of medicine and sports performance. In medicine, IGF-1 DES has been investigated as a potential treatment for muscle wasting, diabetes, and neurodegenerative diseases. In sports performance, IGF-1 DES has been used to enhance muscle hypertrophy, improve recovery, and promote fat loss.
The Benefits of IGF DES
Benefits of Insulin-like Growth Factor 1 include:
Increased Protein synthesis in the body
Fat storage is forced for energy production, which results in a noticeable fat loss.
Elevated recovery and repair
Positive effects on metabolism, increasing lean body mass and decreasing fat
Increase in regenerative properties of the body's nerve tissues
Upregulates antioxidant benefit and ligament strength
Boosts hyperplasia in muscle cells, which leads to fuller muscle tissues.
Improved cognitive function
Gives many anti-aging properties
The various researches conducted on this peptide have observed that it offers many benefits to users. The peptide provides a possible mental boost. It has given cognitive advantages in members through excitatory neurotransmitters (enabling the communication that occurs between a neuron to some other cell type in the body) of the hippocampus which is a piece of the limbic framework that includes a short-term memory and long-haul memory and spatial route. It is useful to old-aged patients, as a suitable compound to help memory issue like Alzheimer sickness.
IGF-1 DES has been defined as a delicate chain due to its half-life of 20-30 minutes. Its efficacy is remarkable in the specific injected area but it does not have effects on overall growth. That is why it is necessary to identify the muscle groups near to the target area of application to accomplish the best results.
During training, IGF-1 DES binds to receptors deformed by lactic acid to enhance tissue growth. This peptide has the faculty to recover damaged tissue and muscle growth, which derives an improvement in physical performance. This feature can call the attention of athletes who are in search of a rapid development of their muscle.
Dosing
Now, back to dosing. The proper dose depends on whether you are a male or female. For men, the dose tops off at 50mcg per day with the lower end being around 40mcg. As for women, this dose is nearly cut in half in that it reduces down to 20mcg daily instead of the 40 to 50mcg for men.
One other thing to keep in mind is that the results may not be immediately noticeable. It may actually take a few weeks to notice the differences from the use of your IGF DES. The differences are usually noticeable around three to six months of taking it. Of course, other external factors such as age, weight, and your health history also factor in to how quickly the peptide will work as well.
So, although it may take some time to fully reap the benefits of the peptide, at least you'll see results that you've been waiting for. The next step is finding out where you can buy the best IGF DES so that you know it is highly effective and will get you to where you need to be. We can help with that.
Conclusion:
IGF-1 DES is a truncated form of the IGF-1 protein hormone that has a higher affinity for the IGF-1 receptor than the native IGF-1 protein. It exerts its effects by activating a signaling pathway that promotes cell growth, differentiation, and survival. IGF-1 DES has a wide range of applications in medicine and sports performance, but its use in humans is currently prohibited by the WADA. Further research is needed to fully understand the potential benefits and risks of using IGF-1 DES.
Hot Tags: igf-1 des, China igf-1 des manufacturers, suppliers, factory, Testosterone Enanthate 250, Testosterone Enanthate Powder, Fladrafinil, Pain Relief, Masteron 100, Finasteride













